Anti LPIN3 pAb (ATL-HPA070640)

Atlas Antibodies

Catalog No: ATL-HPA070640-25

• 

Product Description

Protein Description: lipin 3
Gene Name: LPIN3
Alternative Gene Name: LIPN3L, SMP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027412: 81%, ENSRNOG00000016636: 89%
Entrez Gene ID: 64900
Uniprot ID: Q9BQK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LIQELIKNHKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWREPLPAVDLDT
• Gene Sequence: LIQELIKNHKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWREPLPAVDLDT
• Gene ID - Mouse: ENSMUSG00000027412
• Gene ID - Rat: ENSRNOG00000016636
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.