Description
Product Description
Protein Description: lipin 3
Gene Name: LPIN3
Alternative Gene Name: LIPN3L, SMP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027412: 81%, ENSRNOG00000016636: 89%
Entrez Gene ID: 64900
Uniprot ID: Q9BQK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LPIN3
Alternative Gene Name: LIPN3L, SMP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027412: 81%, ENSRNOG00000016636: 89%
Entrez Gene ID: 64900
Uniprot ID: Q9BQK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LIQELIKNHKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWREPLPAVDLDT |
Gene Sequence | LIQELIKNHKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWREPLPAVDLDT |
Gene ID - Mouse | ENSMUSG00000027412 |
Gene ID - Rat | ENSRNOG00000016636 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LPIN3 pAb (ATL-HPA070640) | |
Datasheet | Anti LPIN3 pAb (ATL-HPA070640) Datasheet (External Link) |
Vendor Page | Anti LPIN3 pAb (ATL-HPA070640) at Atlas Antibodies |
Documents & Links for Anti LPIN3 pAb (ATL-HPA070640) | |
Datasheet | Anti LPIN3 pAb (ATL-HPA070640) Datasheet (External Link) |
Vendor Page | Anti LPIN3 pAb (ATL-HPA070640) |