Description
Product Description
Protein Description: lysyl oxidase-like 2
Gene Name: LOXL2
Alternative Gene Name: WS9-14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034205: 78%, ENSRNOG00000016758: 76%
Entrez Gene ID: 4017
Uniprot ID: Q9Y4K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LOXL2
Alternative Gene Name: WS9-14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034205: 78%, ENSRNOG00000016758: 76%
Entrez Gene ID: 4017
Uniprot ID: Q9Y4K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLP |
Gene Sequence | FGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLP |
Gene ID - Mouse | ENSMUSG00000034205 |
Gene ID - Rat | ENSRNOG00000016758 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LOXL2 pAb (ATL-HPA056542) | |
Datasheet | Anti LOXL2 pAb (ATL-HPA056542) Datasheet (External Link) |
Vendor Page | Anti LOXL2 pAb (ATL-HPA056542) at Atlas Antibodies |
Documents & Links for Anti LOXL2 pAb (ATL-HPA056542) | |
Datasheet | Anti LOXL2 pAb (ATL-HPA056542) Datasheet (External Link) |
Vendor Page | Anti LOXL2 pAb (ATL-HPA056542) |