Description
Product Description
Protein Description: lipoxygenase homology domains 1
Gene Name: LOXHD1
Alternative Gene Name: DFNB77, FLJ32670, LH2D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032818: 86%, ENSRNOG00000017410: 86%
Entrez Gene ID: 125336
Uniprot ID: Q8IVV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LOXHD1
Alternative Gene Name: DFNB77, FLJ32670, LH2D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032818: 86%, ENSRNOG00000017410: 86%
Entrez Gene ID: 125336
Uniprot ID: Q8IVV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSV |
Gene Sequence | SPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSV |
Gene ID - Mouse | ENSMUSG00000032818 |
Gene ID - Rat | ENSRNOG00000017410 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LOXHD1 pAb (ATL-HPA077128) | |
Datasheet | Anti LOXHD1 pAb (ATL-HPA077128) Datasheet (External Link) |
Vendor Page | Anti LOXHD1 pAb (ATL-HPA077128) at Atlas Antibodies |
Documents & Links for Anti LOXHD1 pAb (ATL-HPA077128) | |
Datasheet | Anti LOXHD1 pAb (ATL-HPA077128) Datasheet (External Link) |
Vendor Page | Anti LOXHD1 pAb (ATL-HPA077128) |