Anti LONRF3 pAb (ATL-HPA061162)

Atlas Antibodies

Catalog No: ATL-HPA061162-100

• 
• 

Product Description

Protein Description: LON peptidase N-terminal domain and ring finger 3
Gene Name: LONRF3
Alternative Gene Name: FLJ22612, RNF127
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016239: 47%, ENSRNOG00000013092: 47%
Entrez Gene ID: 79836
Uniprot ID: Q496Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQ
• Gene Sequence: MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQ
• Gene ID - Mouse: ENSMUSG00000016239
• Gene ID - Rat: ENSRNOG00000013092
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.