Protein Description: LIM homeobox transcription factor 1, beta
Gene Name: LMX1B
Alternative Gene Name: NPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038765: 67%, ENSRNOG00000017019: 100%
Entrez Gene ID: 4010
Uniprot ID: O60663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LMX1B
Alternative Gene Name: NPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038765: 67%, ENSRNOG00000017019: 100%
Entrez Gene ID: 4010
Uniprot ID: O60663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL |
| Documents & Links for Anti LMX1B pAb (ATL-HPA073716) | |
| Datasheet | Anti LMX1B pAb (ATL-HPA073716) Datasheet (External Link) |
| Vendor Page | Anti LMX1B pAb (ATL-HPA073716) at Atlas |
| Documents & Links for Anti LMX1B pAb (ATL-HPA073716) | |
| Datasheet | Anti LMX1B pAb (ATL-HPA073716) Datasheet (External Link) |
| Vendor Page | Anti LMX1B pAb (ATL-HPA073716) |