Anti LMX1B pAb (ATL-HPA073716)

Catalog No:
ATL-HPA073716-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: LIM homeobox transcription factor 1, beta
Gene Name: LMX1B
Alternative Gene Name: NPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038765: 67%, ENSRNOG00000017019: 100%
Entrez Gene ID: 4010
Uniprot ID: O60663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL
Gene ID - Mouse ENSMUSG00000038765
Gene ID - Rat ENSMUSG00000038765
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti LMX1B pAb (ATL-HPA073716)
Datasheet Anti LMX1B pAb (ATL-HPA073716) Datasheet (External Link)
Vendor Page Anti LMX1B pAb (ATL-HPA073716) at Atlas

Documents & Links for Anti LMX1B pAb (ATL-HPA073716)
Datasheet Anti LMX1B pAb (ATL-HPA073716) Datasheet (External Link)
Vendor Page Anti LMX1B pAb (ATL-HPA073716)