Protein Description: LIM homeobox transcription factor 1, beta
Gene Name: LMX1B
Alternative Gene Name: NPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038765: 67%, ENSRNOG00000017019: 100%
Entrez Gene ID: 4010
Uniprot ID: O60663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LMX1B
Alternative Gene Name: NPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038765: 67%, ENSRNOG00000017019: 100%
Entrez Gene ID: 4010
Uniprot ID: O60663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL |
Gene Sequence | DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL |
Gene ID - Mouse | ENSMUSG00000038765 |
Gene ID - Rat | ENSRNOG00000017019 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LMX1B pAb (ATL-HPA073716) | |
Datasheet | Anti LMX1B pAb (ATL-HPA073716) Datasheet (External Link) |
Vendor Page | Anti LMX1B pAb (ATL-HPA073716) at Atlas Antibodies |
Documents & Links for Anti LMX1B pAb (ATL-HPA073716) | |
Datasheet | Anti LMX1B pAb (ATL-HPA073716) Datasheet (External Link) |
Vendor Page | Anti LMX1B pAb (ATL-HPA073716) |