Protein Description: lemur tyrosine kinase 3
Gene Name: LMTK3
Alternative Gene Name: KIAA1883, LMR3, PPP1R101, TYKLM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062044: 91%, ENSRNOG00000009687: 34%
Entrez Gene ID: 114783
Uniprot ID: Q96Q04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LMTK3
Alternative Gene Name: KIAA1883, LMR3, PPP1R101, TYKLM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062044: 91%, ENSRNOG00000009687: 34%
Entrez Gene ID: 114783
Uniprot ID: Q96Q04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDP |
Gene ID - Mouse | ENSMUSG00000062044 |
Gene ID - Rat | ENSMUSG00000062044 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LMTK3 pAb (ATL-HPA077070) | |
Datasheet | Anti LMTK3 pAb (ATL-HPA077070) Datasheet (External Link) |
Vendor Page | Anti LMTK3 pAb (ATL-HPA077070) at Atlas |
Documents & Links for Anti LMTK3 pAb (ATL-HPA077070) | |
Datasheet | Anti LMTK3 pAb (ATL-HPA077070) Datasheet (External Link) |
Vendor Page | Anti LMTK3 pAb (ATL-HPA077070) |