Protein Description: LIM domain only 2
Gene Name: LMO2
Alternative Gene Name: RBTN2, RBTNL1, RHOM2, TTG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032698: 99%, ENSRNOG00000009401: 99%
Entrez Gene ID: 4005
Uniprot ID: P25791
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LMO2
Alternative Gene Name: RBTN2, RBTNL1, RHOM2, TTG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032698: 99%, ENSRNOG00000009401: 99%
Entrez Gene ID: 4005
Uniprot ID: P25791
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM |
| Documents & Links for Anti LMO2 pAb (ATL-HPA070910) | |
| Datasheet | Anti LMO2 pAb (ATL-HPA070910) Datasheet (External Link) |
| Vendor Page | Anti LMO2 pAb (ATL-HPA070910) at Atlas |
| Documents & Links for Anti LMO2 pAb (ATL-HPA070910) | |
| Datasheet | Anti LMO2 pAb (ATL-HPA070910) Datasheet (External Link) |
| Vendor Page | Anti LMO2 pAb (ATL-HPA070910) |