Protein Description: lamin tail domain containing 2
Gene Name: LMNTD2
Alternative Gene Name: C11orf35, MGC35138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025500: 75%, ENSRNOG00000017050: 73%
Entrez Gene ID: 256329
Uniprot ID: Q8IXW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LMNTD2
Alternative Gene Name: C11orf35, MGC35138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025500: 75%, ENSRNOG00000017050: 73%
Entrez Gene ID: 256329
Uniprot ID: Q8IXW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LEERLLQTTRTLQEMEAELQNLQKSCLLQLARSSWVGRMLRSQTGSVEVVTAETLMDPSDLSE |
| Documents & Links for Anti LMNTD2 pAb (ATL-HPA073912) | |
| Datasheet | Anti LMNTD2 pAb (ATL-HPA073912) Datasheet (External Link) |
| Vendor Page | Anti LMNTD2 pAb (ATL-HPA073912) at Atlas |
| Documents & Links for Anti LMNTD2 pAb (ATL-HPA073912) | |
| Datasheet | Anti LMNTD2 pAb (ATL-HPA073912) Datasheet (External Link) |
| Vendor Page | Anti LMNTD2 pAb (ATL-HPA073912) |