Anti LMNB2 pAb (ATL-HPA062477)

Catalog No:
ATL-HPA062477-25
$303.00

Description

Product Description

Protein Description: lamin B2
Gene Name: LMNB2
Alternative Gene Name: LMN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062075: 71%, ENSRNOG00000025742: 71%
Entrez Gene ID: 84823
Uniprot ID: Q03252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEE
Gene Sequence PSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEE
Gene ID - Mouse ENSMUSG00000062075
Gene ID - Rat ENSRNOG00000025742
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LMNB2 pAb (ATL-HPA062477)
Datasheet Anti LMNB2 pAb (ATL-HPA062477) Datasheet (External Link)
Vendor Page Anti LMNB2 pAb (ATL-HPA062477) at Atlas Antibodies

Documents & Links for Anti LMNB2 pAb (ATL-HPA062477)
Datasheet Anti LMNB2 pAb (ATL-HPA062477) Datasheet (External Link)
Vendor Page Anti LMNB2 pAb (ATL-HPA062477)

Product Description

Protein Description: lamin B2
Gene Name: LMNB2
Alternative Gene Name: LMN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062075: 71%, ENSRNOG00000025742: 71%
Entrez Gene ID: 84823
Uniprot ID: Q03252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEE
Gene Sequence PSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEE
Gene ID - Mouse ENSMUSG00000062075
Gene ID - Rat ENSRNOG00000025742
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LMNB2 pAb (ATL-HPA062477)
Datasheet Anti LMNB2 pAb (ATL-HPA062477) Datasheet (External Link)
Vendor Page Anti LMNB2 pAb (ATL-HPA062477) at Atlas Antibodies

Documents & Links for Anti LMNB2 pAb (ATL-HPA062477)
Datasheet Anti LMNB2 pAb (ATL-HPA062477) Datasheet (External Link)
Vendor Page Anti LMNB2 pAb (ATL-HPA062477)