Description
Product Description
Protein Description: limb and CNS expressed 1 like
Gene Name: LIX1L
Alternative Gene Name: MGC46719
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049288: 100%, ENSRNOG00000021213: 98%
Entrez Gene ID: 128077
Uniprot ID: Q8IVB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LIX1L
Alternative Gene Name: MGC46719
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049288: 100%, ENSRNOG00000021213: 98%
Entrez Gene ID: 128077
Uniprot ID: Q8IVB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGALVVYEMVPSNSPPYV |
Gene Sequence | PAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGALVVYEMVPSNSPPYV |
Gene ID - Mouse | ENSMUSG00000049288 |
Gene ID - Rat | ENSRNOG00000021213 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LIX1L pAb (ATL-HPA063598) | |
Datasheet | Anti LIX1L pAb (ATL-HPA063598) Datasheet (External Link) |
Vendor Page | Anti LIX1L pAb (ATL-HPA063598) at Atlas Antibodies |
Documents & Links for Anti LIX1L pAb (ATL-HPA063598) | |
Datasheet | Anti LIX1L pAb (ATL-HPA063598) Datasheet (External Link) |
Vendor Page | Anti LIX1L pAb (ATL-HPA063598) |