Description
Product Description
Protein Description: Lix1 homolog (chicken)
Gene Name: LIX1
Alternative Gene Name: C5orf11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047786: 98%, ENSRNOG00000012988: 98%
Entrez Gene ID: 167410
Uniprot ID: Q8N485
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LIX1
Alternative Gene Name: C5orf11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047786: 98%, ENSRNOG00000012988: 98%
Entrez Gene ID: 167410
Uniprot ID: Q8N485
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RRITKEFIMESVQEAVASTSGTLDDADDPSTSVGAYHYMLESNMGKT |
| Gene Sequence | RRITKEFIMESVQEAVASTSGTLDDADDPSTSVGAYHYMLESNMGKT |
| Gene ID - Mouse | ENSMUSG00000047786 |
| Gene ID - Rat | ENSRNOG00000012988 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti LIX1 pAb (ATL-HPA058426) | |
| Datasheet | Anti LIX1 pAb (ATL-HPA058426) Datasheet (External Link) |
| Vendor Page | Anti LIX1 pAb (ATL-HPA058426) at Atlas Antibodies |
| Documents & Links for Anti LIX1 pAb (ATL-HPA058426) | |
| Datasheet | Anti LIX1 pAb (ATL-HPA058426) Datasheet (External Link) |
| Vendor Page | Anti LIX1 pAb (ATL-HPA058426) |