Description
Product Description
Protein Description: leucine rich repeat and Ig domain containing 3
Gene Name: LINGO3
Alternative Gene Name: LERN2, LRRN6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051067: 94%, ENSRNOG00000032569: 94%
Entrez Gene ID: 645191
Uniprot ID: P0C6S8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LINGO3
Alternative Gene Name: LERN2, LRRN6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051067: 94%, ENSRNOG00000032569: 94%
Entrez Gene ID: 645191
Uniprot ID: P0C6S8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR |
Gene Sequence | LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR |
Gene ID - Mouse | ENSMUSG00000051067 |
Gene ID - Rat | ENSRNOG00000032569 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LINGO3 pAb (ATL-HPA055932) | |
Datasheet | Anti LINGO3 pAb (ATL-HPA055932) Datasheet (External Link) |
Vendor Page | Anti LINGO3 pAb (ATL-HPA055932) at Atlas Antibodies |
Documents & Links for Anti LINGO3 pAb (ATL-HPA055932) | |
Datasheet | Anti LINGO3 pAb (ATL-HPA055932) Datasheet (External Link) |
Vendor Page | Anti LINGO3 pAb (ATL-HPA055932) |