Protein Description: leucine rich repeat and Ig domain containing 1
Gene Name: LINGO1
Alternative Gene Name: FLJ14594, LERN1, LRRN6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049556: 100%, ENSRNOG00000017193: 100%
Entrez Gene ID: 84894
Uniprot ID: Q96FE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LINGO1
Alternative Gene Name: FLJ14594, LERN1, LRRN6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049556: 100%, ENSRNOG00000017193: 100%
Entrez Gene ID: 84894
Uniprot ID: Q96FE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV |
Documents & Links for Anti LINGO1 pAb (ATL-HPA074653 w/enhanced validation) | |
Datasheet | Anti LINGO1 pAb (ATL-HPA074653 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LINGO1 pAb (ATL-HPA074653 w/enhanced validation) at Atlas |
Documents & Links for Anti LINGO1 pAb (ATL-HPA074653 w/enhanced validation) | |
Datasheet | Anti LINGO1 pAb (ATL-HPA074653 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LINGO1 pAb (ATL-HPA074653 w/enhanced validation) |