Protein Description: long intergenic non-protein coding RNA 493
Gene Name: LINC00493
Alternative Gene Name: LOC388789
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074754: 38%, ENSRNOG00000036971: 37%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LINC00493
Alternative Gene Name: LOC388789
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074754: 38%, ENSRNOG00000036971: 37%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP |
Documents & Links for Anti LINC00493 pAb (ATL-HPA068733) | |
Datasheet | Anti LINC00493 pAb (ATL-HPA068733) Datasheet (External Link) |
Vendor Page | Anti LINC00493 pAb (ATL-HPA068733) at Atlas |
Documents & Links for Anti LINC00493 pAb (ATL-HPA068733) | |
Datasheet | Anti LINC00493 pAb (ATL-HPA068733) Datasheet (External Link) |
Vendor Page | Anti LINC00493 pAb (ATL-HPA068733) |