Anti LINC00493 pAb (ATL-HPA068733)

Atlas Antibodies

Catalog No: ATL-HPA068733-25

• 

Product Description

Protein Description: long intergenic non-protein coding RNA 493
Gene Name: LINC00493
Alternative Gene Name: LOC388789
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074754: 38%, ENSRNOG00000036971: 37%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP
• Gene Sequence: SLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP
• Gene ID - Mouse: ENSMUSG00000074754
• Gene ID - Rat: ENSRNOG00000036971
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.