Protein Description: lin-7 homolog A, crumbs cell polarity complex component
Gene Name: LIN7A
Alternative Gene Name: LIN-7A, MALS-1, TIP-33, VELI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019906: 91%, ENSRNOG00000004527: 91%
Entrez Gene ID: 8825
Uniprot ID: O14910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LIN7A
Alternative Gene Name: LIN-7A, MALS-1, TIP-33, VELI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019906: 91%, ENSRNOG00000004527: 91%
Entrez Gene ID: 8825
Uniprot ID: O14910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV |
| Documents & Links for Anti LIN7A pAb (ATL-HPA071562) | |
| Datasheet | Anti LIN7A pAb (ATL-HPA071562) Datasheet (External Link) |
| Vendor Page | Anti LIN7A pAb (ATL-HPA071562) at Atlas |
| Documents & Links for Anti LIN7A pAb (ATL-HPA071562) | |
| Datasheet | Anti LIN7A pAb (ATL-HPA071562) Datasheet (External Link) |
| Vendor Page | Anti LIN7A pAb (ATL-HPA071562) |