Protein Description: lin-28 homolog A
Gene Name: LIN28A
Alternative Gene Name: CSDD1, FLJ12457, LIN-28, LIN28, ZCCHC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050966: 96%, ENSRNOG00000060320: 96%
Entrez Gene ID: 79727
Uniprot ID: Q9H9Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LIN28A
Alternative Gene Name: CSDD1, FLJ12457, LIN-28, LIN28, ZCCHC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050966: 96%, ENSRNOG00000060320: 96%
Entrez Gene ID: 79727
Uniprot ID: Q9H9Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVR |
Documents & Links for Anti LIN28A pAb (ATL-HPA068814) | |
Datasheet | Anti LIN28A pAb (ATL-HPA068814) Datasheet (External Link) |
Vendor Page | Anti LIN28A pAb (ATL-HPA068814) at Atlas |
Documents & Links for Anti LIN28A pAb (ATL-HPA068814) | |
Datasheet | Anti LIN28A pAb (ATL-HPA068814) Datasheet (External Link) |
Vendor Page | Anti LIN28A pAb (ATL-HPA068814) |