Description
Product Description
Protein Description: LIM and senescent cell antigen-like domains 1
Gene Name: LIMS1
Alternative Gene Name: PINCH, PINCH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027684: 31%, ENSRNOG00000037765: 95%
Entrez Gene ID: 3987
Uniprot ID: P48059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LIMS1
Alternative Gene Name: PINCH, PINCH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027684: 31%, ENSRNOG00000037765: 95%
Entrez Gene ID: 3987
Uniprot ID: P48059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNMANAL |
Gene Sequence | MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNMANAL |
Gene ID - Mouse | ENSMUSG00000027684 |
Gene ID - Rat | ENSRNOG00000037765 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LIMS1 pAb (ATL-HPA061230) | |
Datasheet | Anti LIMS1 pAb (ATL-HPA061230) Datasheet (External Link) |
Vendor Page | Anti LIMS1 pAb (ATL-HPA061230) at Atlas Antibodies |
Documents & Links for Anti LIMS1 pAb (ATL-HPA061230) | |
Datasheet | Anti LIMS1 pAb (ATL-HPA061230) Datasheet (External Link) |
Vendor Page | Anti LIMS1 pAb (ATL-HPA061230) |