Description
Product Description
Protein Description: LIM and senescent cell antigen-like domains 1
Gene Name: LIMS1
Alternative Gene Name: PINCH, PINCH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019920: 84%, ENSRNOG00000037765: 80%
Entrez Gene ID: 3987
Uniprot ID: P48059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LIMS1
Alternative Gene Name: PINCH, PINCH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019920: 84%, ENSRNOG00000037765: 80%
Entrez Gene ID: 3987
Uniprot ID: P48059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVY |
| Gene Sequence | MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVY |
| Gene ID - Mouse | ENSMUSG00000019920 |
| Gene ID - Rat | ENSRNOG00000037765 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti LIMS1 pAb (ATL-HPA058455) | |
| Datasheet | Anti LIMS1 pAb (ATL-HPA058455) Datasheet (External Link) |
| Vendor Page | Anti LIMS1 pAb (ATL-HPA058455) at Atlas Antibodies |
| Documents & Links for Anti LIMS1 pAb (ATL-HPA058455) | |
| Datasheet | Anti LIMS1 pAb (ATL-HPA058455) Datasheet (External Link) |
| Vendor Page | Anti LIMS1 pAb (ATL-HPA058455) |