![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101143/181199/atl-hpa073571_anti-limk1-pab-atl-hpa073571_62867__72635.1681137471.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: LIM domain kinase 1
Gene Name: LIMK1
Alternative Gene Name: LIMK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029674: 97%, ENSRNOG00000001470: 95%
Entrez Gene ID: 3984
Uniprot ID: P53667
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LIMK1
Alternative Gene Name: LIMK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029674: 97%, ENSRNOG00000001470: 95%
Entrez Gene ID: 3984
Uniprot ID: P53667
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGL |
| Documents & Links for Anti LIMK1 pAb (ATL-HPA073571) | |
| Datasheet | Anti LIMK1 pAb (ATL-HPA073571) Datasheet (External Link) |
| Vendor Page | Anti LIMK1 pAb (ATL-HPA073571) at Atlas |
| Documents & Links for Anti LIMK1 pAb (ATL-HPA073571) | |
| Datasheet | Anti LIMK1 pAb (ATL-HPA073571) Datasheet (External Link) |
| Vendor Page | Anti LIMK1 pAb (ATL-HPA073571) |