Anti LIMK1 pAb (ATL-HPA073571)

Atlas Antibodies

Catalog No: ATL-HPA073571-25

• 
• 

Product Description

Protein Description: LIM domain kinase 1
Gene Name: LIMK1
Alternative Gene Name: LIMK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029674: 97%, ENSRNOG00000001470: 95%
Entrez Gene ID: 3984
Uniprot ID: P53667
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGL
• Gene Sequence: MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGL
• Gene ID - Mouse: ENSMUSG00000029674
• Gene ID - Rat: ENSRNOG00000001470
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.