Anti LIMD2 pAb (ATL-HPA075172)

Catalog No:
ATL-HPA075172-25
$447.00

Description

Product Description

Protein Description: LIM domain containing 2
Gene Name: LIMD2
Alternative Gene Name: MGC10986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040699: 93%, ENSRNOG00000025448: 91%
Entrez Gene ID: 80774
Uniprot ID: Q9BT23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKT
Gene Sequence FQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKT
Gene ID - Mouse ENSMUSG00000040699
Gene ID - Rat ENSRNOG00000025448
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LIMD2 pAb (ATL-HPA075172)
Datasheet Anti LIMD2 pAb (ATL-HPA075172) Datasheet (External Link)
Vendor Page Anti LIMD2 pAb (ATL-HPA075172) at Atlas Antibodies

Documents & Links for Anti LIMD2 pAb (ATL-HPA075172)
Datasheet Anti LIMD2 pAb (ATL-HPA075172) Datasheet (External Link)
Vendor Page Anti LIMD2 pAb (ATL-HPA075172)

Product Description

Protein Description: LIM domain containing 2
Gene Name: LIMD2
Alternative Gene Name: MGC10986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040699: 93%, ENSRNOG00000025448: 91%
Entrez Gene ID: 80774
Uniprot ID: Q9BT23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKT
Gene Sequence FQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKT
Gene ID - Mouse ENSMUSG00000040699
Gene ID - Rat ENSRNOG00000025448
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LIMD2 pAb (ATL-HPA075172)
Datasheet Anti LIMD2 pAb (ATL-HPA075172) Datasheet (External Link)
Vendor Page Anti LIMD2 pAb (ATL-HPA075172) at Atlas Antibodies

Documents & Links for Anti LIMD2 pAb (ATL-HPA075172)
Datasheet Anti LIMD2 pAb (ATL-HPA075172) Datasheet (External Link)
Vendor Page Anti LIMD2 pAb (ATL-HPA075172)