Protein Description: LIM domain containing 2
Gene Name: LIMD2
Alternative Gene Name: MGC10986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040699: 93%, ENSRNOG00000025448: 91%
Entrez Gene ID: 80774
Uniprot ID: Q9BT23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LIMD2
Alternative Gene Name: MGC10986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040699: 93%, ENSRNOG00000025448: 91%
Entrez Gene ID: 80774
Uniprot ID: Q9BT23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKT |
| Documents & Links for Anti LIMD2 pAb (ATL-HPA075172) | |
| Datasheet | Anti LIMD2 pAb (ATL-HPA075172) Datasheet (External Link) |
| Vendor Page | Anti LIMD2 pAb (ATL-HPA075172) at Atlas |
| Documents & Links for Anti LIMD2 pAb (ATL-HPA075172) | |
| Datasheet | Anti LIMD2 pAb (ATL-HPA075172) Datasheet (External Link) |
| Vendor Page | Anti LIMD2 pAb (ATL-HPA075172) |