Anti LIMD2 pAb (ATL-HPA062432)

Atlas Antibodies

Catalog No: ATL-HPA062432-25

• 

Product Description

Protein Description: LIM domain containing 2
Gene Name: LIMD2
Alternative Gene Name: MGC10986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040699: 93%, ENSRNOG00000025448: 91%
Entrez Gene ID: 80774
Uniprot ID: Q9BT23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKT
• Gene Sequence: FQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKT
• Gene ID - Mouse: ENSMUSG00000040699
• Gene ID - Rat: ENSRNOG00000025448
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.