![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100830/180816/atl-hpa071736_anti-limd1-pab-atl-hpa071736_62484__20496.1681136996.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: LIM domains containing 1
Gene Name: LIMD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025239: 100%, ENSRNOG00000004837: 98%
Entrez Gene ID: 8994
Uniprot ID: Q9UGP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LIMD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025239: 100%, ENSRNOG00000004837: 98%
Entrez Gene ID: 8994
Uniprot ID: Q9UGP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQ |
| Documents & Links for Anti LIMD1 pAb (ATL-HPA071736) | |
| Datasheet | Anti LIMD1 pAb (ATL-HPA071736) Datasheet (External Link) |
| Vendor Page | Anti LIMD1 pAb (ATL-HPA071736) at Atlas |
| Documents & Links for Anti LIMD1 pAb (ATL-HPA071736) | |
| Datasheet | Anti LIMD1 pAb (ATL-HPA071736) Datasheet (External Link) |
| Vendor Page | Anti LIMD1 pAb (ATL-HPA071736) |