Anti LIMD1 pAb (ATL-HPA071736)

Catalog No:
ATL-HPA071736-25
$447.00

Description

Product Description

Protein Description: LIM domains containing 1
Gene Name: LIMD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025239: 100%, ENSRNOG00000004837: 98%
Entrez Gene ID: 8994
Uniprot ID: Q9UGP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQ
Gene Sequence MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQ
Gene ID - Mouse ENSMUSG00000025239
Gene ID - Rat ENSRNOG00000004837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LIMD1 pAb (ATL-HPA071736)
Datasheet Anti LIMD1 pAb (ATL-HPA071736) Datasheet (External Link)
Vendor Page Anti LIMD1 pAb (ATL-HPA071736) at Atlas Antibodies

Documents & Links for Anti LIMD1 pAb (ATL-HPA071736)
Datasheet Anti LIMD1 pAb (ATL-HPA071736) Datasheet (External Link)
Vendor Page Anti LIMD1 pAb (ATL-HPA071736)

Product Description

Protein Description: LIM domains containing 1
Gene Name: LIMD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025239: 100%, ENSRNOG00000004837: 98%
Entrez Gene ID: 8994
Uniprot ID: Q9UGP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQ
Gene Sequence MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQ
Gene ID - Mouse ENSMUSG00000025239
Gene ID - Rat ENSRNOG00000004837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LIMD1 pAb (ATL-HPA071736)
Datasheet Anti LIMD1 pAb (ATL-HPA071736) Datasheet (External Link)
Vendor Page Anti LIMD1 pAb (ATL-HPA071736) at Atlas Antibodies

Documents & Links for Anti LIMD1 pAb (ATL-HPA071736)
Datasheet Anti LIMD1 pAb (ATL-HPA071736) Datasheet (External Link)
Vendor Page Anti LIMD1 pAb (ATL-HPA071736)