Protein Description: LIM and calponin homology domains 1
Gene Name: LIMCH1
Alternative Gene Name: DKFZP686A01247, LIMCH1A, LMO7B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037736: 95%, ENSRNOG00000002318: 95%
Entrez Gene ID: 22998
Uniprot ID: Q9UPQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LIMCH1
Alternative Gene Name: DKFZP686A01247, LIMCH1A, LMO7B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037736: 95%, ENSRNOG00000002318: 95%
Entrez Gene ID: 22998
Uniprot ID: Q9UPQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASV |
Documents & Links for Anti LIMCH1 pAb (ATL-HPA063840 w/enhanced validation) | |
Datasheet | Anti LIMCH1 pAb (ATL-HPA063840 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LIMCH1 pAb (ATL-HPA063840 w/enhanced validation) at Atlas |
Documents & Links for Anti LIMCH1 pAb (ATL-HPA063840 w/enhanced validation) | |
Datasheet | Anti LIMCH1 pAb (ATL-HPA063840 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LIMCH1 pAb (ATL-HPA063840 w/enhanced validation) |