Protein Description: LIM homeobox 1
Gene Name: LHX1
Alternative Gene Name: LIM-1, LIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018698: 98%, ENSRNOG00000002812: 98%
Entrez Gene ID: 3975
Uniprot ID: P48742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LHX1
Alternative Gene Name: LIM-1, LIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018698: 98%, ENSRNOG00000002812: 98%
Entrez Gene ID: 3975
Uniprot ID: P48742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FVCKEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNL |
| Documents & Links for Anti LHX1 pAb (ATL-HPA074382) | |
| Datasheet | Anti LHX1 pAb (ATL-HPA074382) Datasheet (External Link) |
| Vendor Page | Anti LHX1 pAb (ATL-HPA074382) at Atlas |
| Documents & Links for Anti LHX1 pAb (ATL-HPA074382) | |
| Datasheet | Anti LHX1 pAb (ATL-HPA074382) Datasheet (External Link) |
| Vendor Page | Anti LHX1 pAb (ATL-HPA074382) |