Protein Description: LIM homeobox 1
Gene Name: LHX1
Alternative Gene Name: LIM-1, LIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018698: 99%, ENSRNOG00000002812: 99%
Entrez Gene ID: 3975
Uniprot ID: P48742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LHX1
Alternative Gene Name: LIM-1, LIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018698: 99%, ENSRNOG00000002812: 99%
Entrez Gene ID: 3975
Uniprot ID: P48742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHL |
| Documents & Links for Anti LHX1 pAb (ATL-HPA073521) | |
| Datasheet | Anti LHX1 pAb (ATL-HPA073521) Datasheet (External Link) |
| Vendor Page | Anti LHX1 pAb (ATL-HPA073521) at Atlas |
| Documents & Links for Anti LHX1 pAb (ATL-HPA073521) | |
| Datasheet | Anti LHX1 pAb (ATL-HPA073521) Datasheet (External Link) |
| Vendor Page | Anti LHX1 pAb (ATL-HPA073521) |