Anti LFNG pAb (ATL-HPA069130)

Atlas Antibodies

Catalog No: ATL-HPA069130-100

• 
• 

Product Description

Protein Description: LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Gene Name: LFNG
Alternative Gene Name: SCDO3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029570: 88%, ENSRNOG00000001250: 92%
Entrez Gene ID: 3955
Uniprot ID: Q8NES3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNCSAAH
• Gene Sequence: TKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNCSAAH
• Gene ID - Mouse: ENSMUSG00000029570
• Gene ID - Rat: ENSRNOG00000001250
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.