Description
Product Description
Protein Description: LETM1 domain containing 1
Gene Name: LETMD1
Alternative Gene Name: HCCR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037353: 59%, ENSRNOG00000029855: 66%
Entrez Gene ID: 25875
Uniprot ID: Q6P1Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LETMD1
Alternative Gene Name: HCCR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037353: 59%, ENSRNOG00000029855: 66%
Entrez Gene ID: 25875
Uniprot ID: Q6P1Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRG |
Gene Sequence | FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRG |
Gene ID - Mouse | ENSMUSG00000037353 |
Gene ID - Rat | ENSRNOG00000029855 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LETMD1 pAb (ATL-HPA074361) | |
Datasheet | Anti LETMD1 pAb (ATL-HPA074361) Datasheet (External Link) |
Vendor Page | Anti LETMD1 pAb (ATL-HPA074361) at Atlas Antibodies |
Documents & Links for Anti LETMD1 pAb (ATL-HPA074361) | |
Datasheet | Anti LETMD1 pAb (ATL-HPA074361) Datasheet (External Link) |
Vendor Page | Anti LETMD1 pAb (ATL-HPA074361) |