Description
Product Description
Protein Description: LEM domain containing 3
Gene Name: LEMD3
Alternative Gene Name: MAN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048661: 81%, ENSRNOG00000024027: 80%
Entrez Gene ID: 23592
Uniprot ID: Q9Y2U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LEMD3
Alternative Gene Name: MAN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048661: 81%, ENSRNOG00000024027: 80%
Entrez Gene ID: 23592
Uniprot ID: Q9Y2U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GELSIENPFGETFGKIQESEKTLMMNTLYKLHDRLAQLAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEGIFNTSLQWILENGKDVGIRCVGFGPE |
Gene Sequence | GELSIENPFGETFGKIQESEKTLMMNTLYKLHDRLAQLAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEGIFNTSLQWILENGKDVGIRCVGFGPE |
Gene ID - Mouse | ENSMUSG00000048661 |
Gene ID - Rat | ENSRNOG00000024027 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LEMD3 pAb (ATL-HPA076986 w/enhanced validation) | |
Datasheet | Anti LEMD3 pAb (ATL-HPA076986 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LEMD3 pAb (ATL-HPA076986 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti LEMD3 pAb (ATL-HPA076986 w/enhanced validation) | |
Datasheet | Anti LEMD3 pAb (ATL-HPA076986 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LEMD3 pAb (ATL-HPA076986 w/enhanced validation) |