Description
Product Description
Protein Description: leucine zipper, down-regulated in cancer 1
Gene Name: LDOC1
Alternative Gene Name: BCUR1, Mar7, Mart7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057615: 72%, ENSRNOG00000003409: 81%
Entrez Gene ID: 23641
Uniprot ID: O95751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LDOC1
Alternative Gene Name: BCUR1, Mar7, Mart7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057615: 72%, ENSRNOG00000003409: 81%
Entrez Gene ID: 23641
Uniprot ID: O95751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDD |
| Gene Sequence | ISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDD |
| Gene ID - Mouse | ENSMUSG00000057615 |
| Gene ID - Rat | ENSRNOG00000003409 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti LDOC1 pAb (ATL-HPA061842) | |
| Datasheet | Anti LDOC1 pAb (ATL-HPA061842) Datasheet (External Link) |
| Vendor Page | Anti LDOC1 pAb (ATL-HPA061842) at Atlas Antibodies |
| Documents & Links for Anti LDOC1 pAb (ATL-HPA061842) | |
| Datasheet | Anti LDOC1 pAb (ATL-HPA061842) Datasheet (External Link) |
| Vendor Page | Anti LDOC1 pAb (ATL-HPA061842) |