Protein Description: lactate dehydrogenase D
Gene Name: LDHD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031958: 87%, ENSRNOG00000019036: 89%
Entrez Gene ID: 197257
Uniprot ID: Q86WU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LDHD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031958: 87%, ENSRNOG00000019036: 89%
Entrez Gene ID: 197257
Uniprot ID: Q86WU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CAFPSVQAAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWA |
| Documents & Links for Anti LDHD pAb (ATL-HPA066148) | |
| Datasheet | Anti LDHD pAb (ATL-HPA066148) Datasheet (External Link) |
| Vendor Page | Anti LDHD pAb (ATL-HPA066148) at Atlas |
| Documents & Links for Anti LDHD pAb (ATL-HPA066148) | |
| Datasheet | Anti LDHD pAb (ATL-HPA066148) Datasheet (External Link) |
| Vendor Page | Anti LDHD pAb (ATL-HPA066148) |