Anti LDB3 pAb (ATL-HPA048955 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA048955-25

• 

Product Description

Protein Description: LIM domain binding 3
Gene Name: LDB3
Alternative Gene Name: CMD1C, KIAA0613, PDLIM6, ZASP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021798: 93%, ENSRNOG00000059166: 93%
Entrez Gene ID: 11155
Uniprot ID: O75112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PIGLYSAETLREMAQMYQMSLRGKASGVGLPGGSLPIKDLAVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQS
• Gene Sequence: PIGLYSAETLREMAQMYQMSLRGKASGVGLPGGSLPIKDLAVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQS
• Gene ID - Mouse: ENSMUSG00000021798
• Gene ID - Rat: ENSRNOG00000059166
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.