Description
Product Description
Protein Description: lactase-like
Gene Name: LCTL
Alternative Gene Name: FLJ33279, KLG, KLPH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032401: 75%, ENSRNOG00000009193: 71%
Entrez Gene ID: 197021
Uniprot ID: Q6UWM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LCTL
Alternative Gene Name: FLJ33279, KLG, KLPH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032401: 75%, ENSRNOG00000009193: 71%
Entrez Gene ID: 197021
Uniprot ID: Q6UWM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SIWDVFTHSGKGKVLGNETADVACDGYYKVQEDIILLRELHVNHYRFSLSW |
| Gene Sequence | SIWDVFTHSGKGKVLGNETADVACDGYYKVQEDIILLRELHVNHYRFSLSW |
| Gene ID - Mouse | ENSMUSG00000032401 |
| Gene ID - Rat | ENSRNOG00000009193 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti LCTL pAb (ATL-HPA071640) | |
| Datasheet | Anti LCTL pAb (ATL-HPA071640) Datasheet (External Link) |
| Vendor Page | Anti LCTL pAb (ATL-HPA071640) at Atlas Antibodies |
| Documents & Links for Anti LCTL pAb (ATL-HPA071640) | |
| Datasheet | Anti LCTL pAb (ATL-HPA071640) Datasheet (External Link) |
| Vendor Page | Anti LCTL pAb (ATL-HPA071640) |