Protein Description: ligand dependent nuclear receptor corepressor
Gene Name: LCOR
Alternative Gene Name: FLJ38026, KIAA1795, MLR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025019: 99%, ENSRNOG00000042679: 99%
Entrez Gene ID: 84458
Uniprot ID: Q96JN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LCOR
Alternative Gene Name: FLJ38026, KIAA1795, MLR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025019: 99%, ENSRNOG00000042679: 99%
Entrez Gene ID: 84458
Uniprot ID: Q96JN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQD |
| Documents & Links for Anti LCOR pAb (ATL-HPA077000) | |
| Datasheet | Anti LCOR pAb (ATL-HPA077000) Datasheet (External Link) |
| Vendor Page | Anti LCOR pAb (ATL-HPA077000) at Atlas |
| Documents & Links for Anti LCOR pAb (ATL-HPA077000) | |
| Datasheet | Anti LCOR pAb (ATL-HPA077000) Datasheet (External Link) |
| Vendor Page | Anti LCOR pAb (ATL-HPA077000) |