Protein Description: leucyl-tRNA synthetase 2, mitochondrial
Gene Name: LARS2
Alternative Gene Name: KIAA0028, LEURS, MGC26121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035202: 95%, ENSRNOG00000004760: 95%
Entrez Gene ID: 23395
Uniprot ID: Q15031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LARS2
Alternative Gene Name: KIAA0028, LEURS, MGC26121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035202: 95%, ENSRNOG00000004760: 95%
Entrez Gene ID: 23395
Uniprot ID: Q15031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDALADLPEWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATGEKLTAYTATPE |
| Documents & Links for Anti LARS2 pAb (ATL-HPA066085) | |
| Datasheet | Anti LARS2 pAb (ATL-HPA066085) Datasheet (External Link) |
| Vendor Page | Anti LARS2 pAb (ATL-HPA066085) at Atlas |
| Documents & Links for Anti LARS2 pAb (ATL-HPA066085) | |
| Datasheet | Anti LARS2 pAb (ATL-HPA066085) Datasheet (External Link) |
| Vendor Page | Anti LARS2 pAb (ATL-HPA066085) |