Description
Product Description
Protein Description: lysosomal protein transmembrane 4 alpha
Gene Name: LAPTM4A
Alternative Gene Name: HUMORF13, KIAA0108, LAPTM4, MBNT, Mtrp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020585: 96%, ENSRNOG00000006865: 98%
Entrez Gene ID: 9741
Uniprot ID: Q15012
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LAPTM4A
Alternative Gene Name: HUMORF13, KIAA0108, LAPTM4, MBNT, Mtrp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020585: 96%, ENSRNOG00000006865: 98%
Entrez Gene ID: 9741
Uniprot ID: Q15012
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA |
| Gene Sequence | YKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA |
| Gene ID - Mouse | ENSMUSG00000020585 |
| Gene ID - Rat | ENSRNOG00000006865 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti LAPTM4A pAb (ATL-HPA068554) | |
| Datasheet | Anti LAPTM4A pAb (ATL-HPA068554) Datasheet (External Link) |
| Vendor Page | Anti LAPTM4A pAb (ATL-HPA068554) at Atlas Antibodies |
| Documents & Links for Anti LAPTM4A pAb (ATL-HPA068554) | |
| Datasheet | Anti LAPTM4A pAb (ATL-HPA068554) Datasheet (External Link) |
| Vendor Page | Anti LAPTM4A pAb (ATL-HPA068554) |
Citations
| Citations for Anti LAPTM4A pAb (ATL-HPA068554) – 1 Found |
| Zhang, Weichao; Yang, Xi; Li, Yingxiang; Yu, Linchen; Zhang, Bokai; Zhang, Jianchao; Cho, Woo Jung; Venkatarangan, Varsha; Chen, Liang; Burugula, Bala Bharathi; Bui, Sarah; Wang, Yanzhuang; Duan, Cunming; Kitzman, Jacob O; Li, Ming. GCAF(TMEM251) regulates lysosome biogenesis by activating the mannose-6-phosphate pathway. Nature Communications. 2022;13(1):5351. PubMed |