Protein Description: LanC like 3
Gene Name: LANCL3
Alternative Gene Name: FLJ42925
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047344: 95%, ENSRNOG00000003756: 98%
Entrez Gene ID: 347404
Uniprot ID: Q6ZV70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LANCL3
Alternative Gene Name: FLJ42925
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047344: 95%, ENSRNOG00000003756: 98%
Entrez Gene ID: 347404
Uniprot ID: Q6ZV70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KLAQEVLTPAQIKSICQAILDSGKQYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPSDRELVWQSVDFLMEQE |
| Documents & Links for Anti LANCL3 pAb (ATL-HPA076575) | |
| Datasheet | Anti LANCL3 pAb (ATL-HPA076575) Datasheet (External Link) |
| Vendor Page | Anti LANCL3 pAb (ATL-HPA076575) at Atlas |
| Documents & Links for Anti LANCL3 pAb (ATL-HPA076575) | |
| Datasheet | Anti LANCL3 pAb (ATL-HPA076575) Datasheet (External Link) |
| Vendor Page | Anti LANCL3 pAb (ATL-HPA076575) |