Protein Description: lysosomal-associated membrane protein family, member 5
Gene Name: LAMP5
Alternative Gene Name: BAD-LAMP, C20orf103, dJ1119D9.3, UNC-43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027270: 83%, ENSRNOG00000005457: 93%
Entrez Gene ID: 24141
Uniprot ID: Q9UJQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LAMP5
Alternative Gene Name: BAD-LAMP, C20orf103, dJ1119D9.3, UNC-43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027270: 83%, ENSRNOG00000005457: 93%
Entrez Gene ID: 24141
Uniprot ID: Q9UJQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLA |
Documents & Links for Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation) | |
Datasheet | Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation) at Atlas |
Documents & Links for Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation) | |
Datasheet | Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation) |