Anti LAMC1 pAb (ATL-HPA001909 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA001909-25

• 
• 

Product Description

Protein Description: laminin, gamma 1 (formerly LAMB2)
Gene Name: LAMC1
Alternative Gene Name: LAMB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026478: 86%, ENSRNOG00000002680: 89%
Entrez Gene ID: 3915
Uniprot ID: P11047
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS
• Gene Sequence: STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS
• Gene ID - Mouse: ENSMUSG00000026478
• Gene ID - Rat: ENSRNOG00000002680
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti LAMC1 pAb (ATL-HPA001909 w/enhanced validation) – 5 Found

Arita, Tomohiro; Ichikawa, Daisuke; Konishi, Hirotaka; Komatsu, Shuhei; Shiozaki, Atsushi; Ogino, Shinpei; Fujita, Yuji; Hiramoto, Hidekazu; Hamada, Junichi; Shoda, Katsutoshi; Kosuga, Toshiyuki; Fujiwara, Hitoshi; Okamoto, Kazuma; Otsuji, Eigo. Tumor exosome-mediated promotion of adhesion to mesothelial cells in gastric cancer cells. Oncotarget. 2016;7(35):56855-56863. 

Clotet-Freixas, Sergi; McEvoy, Caitriona M; Batruch, Ihor; Pastrello, Chiara; Kotlyar, Max; Van, Julie Anh Dung; Arambewela, Madhurangi; Boshart, Alex; Farkona, Sofia; Niu, Yun; Li, Yanhong; Famure, Olusegun; Bozovic, Andrea; Kulasingam, Vathany; Chen, Peixuen; Kim, S Joseph; Chan, Emilie; Moshkelgosha, Sajad; Rahman, Syed Ashiqur; Das, Jishnu; Martinu, Tereza; Juvet, Stephen; Jurisica, Igor; Chruscinski, Andrzej; John, Rohan; Konvalinka, Ana. Extracellular Matrix Injury of Kidney Allografts in Antibody-Mediated Rejection: A Proteomics Study. Journal Of The American Society Of Nephrology : Jasn. 2020;31(11):2705-2724. 

Kuhn, Elisabetta; Kurman, Robert J; Soslow, Robert A; Han, Guangming; Sehdev, Ann Smith; Morin, Patrick J; Wang, Tian-Li; Shih, Ie-Ming. The diagnostic and biological implications of laminin expression in serous tubal intraepithelial carcinoma. The American Journal Of Surgical Pathology. 2012;36(12):1826-34. 

Visvanathan, Kala; Shaw, Patricia; May, Betty J; Bahadirli-Talbott, Asli; Kaushiva, Alpana; Risch, Harvey; Narod, Steven; Wang, Tian-Li; Parkash, Vinita; Vang, Russell; Levine, Douglas A; Soslow, Robert; Kurman, Robert; Shih, Ie-Ming. Fallopian Tube Lesions in Women at High Risk for Ovarian Cancer: A Multicenter Study. Cancer Prevention Research (Philadelphia, Pa.). 2018;11(11):697-706. 

Chen, Lin-Yu; Huang, Rui-Lan; Chan, Michael Wy; Yan, Pearlly S; Huang, Tien-Shuo; Wu, Ren-Chin; Suryo Rahmanto, Yohan; Su, Po-Hsuan; Weng, Yu-Chun; Chou, Jian-Liang; Chao, Tai-Kuang; Wang, Yu-Chi; Shih, Ie-Ming; Lai, Hung-Cheng. TET1 reprograms the epithelial ovarian cancer epigenome and reveals casein kinase 2α as a therapeutic target. The Journal Of Pathology. 2019;248(3):363-376.