Protein Description: lactamase beta like 1
Gene Name: LACTBL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070683: 79%, ENSRNOG00000019243: 24%
Entrez Gene ID: 646262
Uniprot ID: A8MY62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LACTBL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070683: 79%, ENSRNOG00000019243: 24%
Entrez Gene ID: 646262
Uniprot ID: A8MY62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PNEYTMYRISSISKIFPVLMLYRLWEEGIVASLDDPLERYASTFTINNPLGLASAEQQGLMDGLEQVGPAPRPSPVTLRRMAS |
| Documents & Links for Anti LACTBL1 pAb (ATL-HPA066810) | |
| Datasheet | Anti LACTBL1 pAb (ATL-HPA066810) Datasheet (External Link) |
| Vendor Page | Anti LACTBL1 pAb (ATL-HPA066810) at Atlas |
| Documents & Links for Anti LACTBL1 pAb (ATL-HPA066810) | |
| Datasheet | Anti LACTBL1 pAb (ATL-HPA066810) Datasheet (External Link) |
| Vendor Page | Anti LACTBL1 pAb (ATL-HPA066810) |