Anti L3MBTL4 pAb (ATL-HPA069042)

Atlas Antibodies

Catalog No: ATL-HPA069042-25

• 

Product Description

Protein Description: l(3)mbt-like 4 (Drosophila)
Gene Name: L3MBTL4
Alternative Gene Name: FLJ35936, HsT1031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041565: 79%, ENSRNOG00000007044: 59%
Entrez Gene ID: 91133
Uniprot ID: Q8NA19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YWCDVNSPYVQPVGWCQENGRTLIAPQGYPNPENFSWTEYLEATQTNAVPAKVFKMRLPHGFL
• Gene Sequence: YWCDVNSPYVQPVGWCQENGRTLIAPQGYPNPENFSWTEYLEATQTNAVPAKVFKMRLPHGFL
• Gene ID - Mouse: ENSMUSG00000041565
• Gene ID - Rat: ENSRNOG00000007044
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.