Protein Description: l(3)mbt-like 4 (Drosophila)
Gene Name: L3MBTL4
Alternative Gene Name: FLJ35936, HsT1031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041565: 83%, ENSRNOG00000025273: 83%
Entrez Gene ID: 91133
Uniprot ID: Q8NA19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: L3MBTL4
Alternative Gene Name: FLJ35936, HsT1031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041565: 83%, ENSRNOG00000025273: 83%
Entrez Gene ID: 91133
Uniprot ID: Q8NA19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IGWCDVTGHPLEVPQRTNDLKILPGQAVCPTPGCRGIGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDRLREQTQANLESD |
Documents & Links for Anti L3MBTL4 pAb (ATL-HPA064194) | |
Datasheet | Anti L3MBTL4 pAb (ATL-HPA064194) Datasheet (External Link) |
Vendor Page | Anti L3MBTL4 pAb (ATL-HPA064194) at Atlas |
Documents & Links for Anti L3MBTL4 pAb (ATL-HPA064194) | |
Datasheet | Anti L3MBTL4 pAb (ATL-HPA064194) Datasheet (External Link) |
Vendor Page | Anti L3MBTL4 pAb (ATL-HPA064194) |