Description
Product Description
Protein Description: l(3)mbt-like 1 (Drosophila)
Gene Name: L3MBTL1
Alternative Gene Name: dJ138B7.3, DKFZp586P1522, KIAA0681, L3MBTL, ZC2HC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035576: 33%, ENSRNOG00000007044: 31%
Entrez Gene ID: 26013
Uniprot ID: Q9Y468
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: L3MBTL1
Alternative Gene Name: dJ138B7.3, DKFZp586P1522, KIAA0681, L3MBTL, ZC2HC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035576: 33%, ENSRNOG00000007044: 31%
Entrez Gene ID: 26013
Uniprot ID: Q9Y468
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | STVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLL |
Gene Sequence | STVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLL |
Gene ID - Mouse | ENSMUSG00000035576 |
Gene ID - Rat | ENSRNOG00000007044 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti L3MBTL1 pAb (ATL-HPA068051) | |
Datasheet | Anti L3MBTL1 pAb (ATL-HPA068051) Datasheet (External Link) |
Vendor Page | Anti L3MBTL1 pAb (ATL-HPA068051) at Atlas Antibodies |
Documents & Links for Anti L3MBTL1 pAb (ATL-HPA068051) | |
Datasheet | Anti L3MBTL1 pAb (ATL-HPA068051) Datasheet (External Link) |
Vendor Page | Anti L3MBTL1 pAb (ATL-HPA068051) |