Anti L2HGDH pAb (ATL-HPA069708)

Atlas Antibodies

Catalog No: ATL-HPA069708-25

• 

Product Description

Protein Description: L-2-hydroxyglutarate dehydrogenase
Gene Name: L2HGDH
Alternative Gene Name: C14orf160, FLJ12618
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020988: 83%, ENSRNOG00000004857: 83%
Entrez Gene ID: 79944
Uniprot ID: Q9H9P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL
• Gene Sequence: ISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL
• Gene ID - Mouse: ENSMUSG00000020988
• Gene ID - Rat: ENSRNOG00000004857
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.