Protein Description: L-2-hydroxyglutarate dehydrogenase
Gene Name: L2HGDH
Alternative Gene Name: C14orf160, FLJ12618
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020988: 83%, ENSRNOG00000004857: 83%
Entrez Gene ID: 79944
Uniprot ID: Q9H9P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: L2HGDH
Alternative Gene Name: C14orf160, FLJ12618
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020988: 83%, ENSRNOG00000004857: 83%
Entrez Gene ID: 79944
Uniprot ID: Q9H9P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL |
| Documents & Links for Anti L2HGDH pAb (ATL-HPA069708) | |
| Datasheet | Anti L2HGDH pAb (ATL-HPA069708) Datasheet (External Link) |
| Vendor Page | Anti L2HGDH pAb (ATL-HPA069708) at Atlas |
| Documents & Links for Anti L2HGDH pAb (ATL-HPA069708) | |
| Datasheet | Anti L2HGDH pAb (ATL-HPA069708) Datasheet (External Link) |
| Vendor Page | Anti L2HGDH pAb (ATL-HPA069708) |