Protein Description: L-2-hydroxyglutarate dehydrogenase
Gene Name: L2HGDH
Alternative Gene Name: C14orf160, FLJ12618
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020988: 81%, ENSRNOG00000004857: 78%
Entrez Gene ID: 79944
Uniprot ID: Q9H9P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: L2HGDH
Alternative Gene Name: C14orf160, FLJ12618
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020988: 81%, ENSRNOG00000004857: 78%
Entrez Gene ID: 79944
Uniprot ID: Q9H9P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEI |
| Documents & Links for Anti L2HGDH pAb (ATL-HPA065409) | |
| Datasheet | Anti L2HGDH pAb (ATL-HPA065409) Datasheet (External Link) |
| Vendor Page | Anti L2HGDH pAb (ATL-HPA065409) at Atlas |
| Documents & Links for Anti L2HGDH pAb (ATL-HPA065409) | |
| Datasheet | Anti L2HGDH pAb (ATL-HPA065409) Datasheet (External Link) |
| Vendor Page | Anti L2HGDH pAb (ATL-HPA065409) |
| Citations for Anti L2HGDH pAb (ATL-HPA065409) – 1 Found |
| Shenoy, Niraj; Bhagat, Tushar D; Cheville, John; Lohse, Christine; Bhattacharyya, Sanchari; Tischer, Alexander; Machha, Venkata; Gordon-Mitchell, Shanisha; Choudhary, Gaurav; Wong, Li-Fan; Gross, LouAnn; Ressigue, Emily; Leibovich, Bradley; Boorjian, Stephen A; Steidl, Ulrich; Wu, Xiaosheng; Pradhan, Kith; Gartrell, Benjamin; Agarwal, Beamon; Pagliaro, Lance; Suzuki, Masako; Greally, John M; Rakheja, Dinesh; Thompson, R Houston; Susztak, Katalin; Witzig, Thomas; Zou, Yiyu; Verma, Amit. Ascorbic acid-induced TET activation mitigates adverse hydroxymethylcytosine loss in renal cell carcinoma. The Journal Of Clinical Investigation. 2019;129(4):1612-1625. PubMed |