Anti KRTDAP pAb (ATL-HPA063474 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA063474-25

• 

Product Description

Protein Description: keratinocyte differentiation-associated protein
Gene Name: KRTDAP
Alternative Gene Name: KDAP, UNQ467
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074199: 38%, ENSRNOG00000010589: 27%
Entrez Gene ID: 388533
Uniprot ID: P60985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALFESIKRKLPFLN
• Gene Sequence: TLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALFESIKRKLPFLN
• Gene ID - Mouse: ENSMUSG00000074199
• Gene ID - Rat: ENSRNOG00000010589
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.