Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation)

Catalog No:
ATL-HPA077918-100
$554.00
Protein Description: keratin 80, type II
Gene Name: KRT80
Alternative Gene Name: KB20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037185: 75%, ENSRNOG00000025994: 81%
Entrez Gene ID: 144501
Uniprot ID: Q6KB66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GEEGRMDSPSATVVSAVQSRCKTAASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE
Gene ID - Mouse ENSMUSG00000037185
Gene ID - Rat ENSMUSG00000037185
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation)
Datasheet Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation) at Atlas

Documents & Links for Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation)
Datasheet Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation)