Protein Description: keratin 80, type II
Gene Name: KRT80
Alternative Gene Name: KB20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037185: 75%, ENSRNOG00000025994: 81%
Entrez Gene ID: 144501
Uniprot ID: Q6KB66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KRT80
Alternative Gene Name: KB20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037185: 75%, ENSRNOG00000025994: 81%
Entrez Gene ID: 144501
Uniprot ID: Q6KB66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GEEGRMDSPSATVVSAVQSRCKTAASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE |
| Documents & Links for Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation) | |
| Datasheet | Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation) at Atlas |
| Documents & Links for Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation) | |
| Datasheet | Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KRT80 pAb (ATL-HPA077918 w/enhanced validation) |