Protein Description: keratin 28, type I
Gene Name: KRT28
Alternative Gene Name: KRT25D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055937: 57%, ENSRNOG00000011846: 60%
Entrez Gene ID: 162605
Uniprot ID: Q7Z3Y7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KRT28
Alternative Gene Name: KRT25D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055937: 57%, ENSRNOG00000011846: 60%
Entrez Gene ID: 162605
Uniprot ID: Q7Z3Y7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FCSLGTLQFCIDKVNISQNTMSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGSHAGGALGNAACIGFAGSEG |
Documents & Links for Anti KRT28 pAb (ATL-HPA066890) | |
Datasheet | Anti KRT28 pAb (ATL-HPA066890) Datasheet (External Link) |
Vendor Page | Anti KRT28 pAb (ATL-HPA066890) at Atlas |
Documents & Links for Anti KRT28 pAb (ATL-HPA066890) | |
Datasheet | Anti KRT28 pAb (ATL-HPA066890) Datasheet (External Link) |
Vendor Page | Anti KRT28 pAb (ATL-HPA066890) |