Protein Description: keratin 222, type II
Gene Name: KRT222
Alternative Gene Name: KA21, KRT222P, MGC45562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035849: 94%, ENSRNOG00000010839: 94%
Entrez Gene ID: 125113
Uniprot ID: Q8N1A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KRT222
Alternative Gene Name: KA21, KRT222P, MGC45562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035849: 94%, ENSRNOG00000010839: 94%
Entrez Gene ID: 125113
Uniprot ID: Q8N1A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VDEVIKEWEGSFFKDNPRLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMRRSCSIPSIKPPST |
| Documents & Links for Anti KRT222 pAb (ATL-HPA069774) | |
| Datasheet | Anti KRT222 pAb (ATL-HPA069774) Datasheet (External Link) |
| Vendor Page | Anti KRT222 pAb (ATL-HPA069774) at Atlas |
| Documents & Links for Anti KRT222 pAb (ATL-HPA069774) | |
| Datasheet | Anti KRT222 pAb (ATL-HPA069774) Datasheet (External Link) |
| Vendor Page | Anti KRT222 pAb (ATL-HPA069774) |