Protein Description: keratin 13
Gene Name: KRT13
Alternative Gene Name: CK13, K13, MGC161462, MGC3781
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034681: 37%, ENSRNOG00000008703: 37%
Entrez Gene ID: 3860
Uniprot ID: P13646
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KRT13
Alternative Gene Name: CK13, K13, MGC161462, MGC3781
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034681: 37%, ENSRNOG00000008703: 37%
Entrez Gene ID: 3860
Uniprot ID: P13646
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP |
| Documents & Links for Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) | |
| Datasheet | Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) at Atlas |
| Documents & Links for Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) | |
| Datasheet | Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) |