Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation)

Catalog No:
ATL-HPA069771-25
$395.00

Description

Product Description

Protein Description: keratin 13
Gene Name: KRT13
Alternative Gene Name: CK13, K13, MGC161462, MGC3781
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034681: 37%, ENSRNOG00000008703: 37%
Entrez Gene ID: 3860
Uniprot ID: P13646
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Gene Sequence EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Gene ID - Mouse ENSMUSG00000034681
Gene ID - Rat ENSRNOG00000008703
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation)
Datasheet Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation)
Datasheet Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation)

Product Description

Protein Description: keratin 13
Gene Name: KRT13
Alternative Gene Name: CK13, K13, MGC161462, MGC3781
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034681: 37%, ENSRNOG00000008703: 37%
Entrez Gene ID: 3860
Uniprot ID: P13646
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Gene Sequence EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Gene ID - Mouse ENSMUSG00000034681
Gene ID - Rat ENSRNOG00000008703
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation)
Datasheet Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation)
Datasheet Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation)